grimmly2007.blogspot

  • Subscribe to our RSS feed.
  • Twitter
  • StumbleUpon
  • Reddit
  • Facebook
  • Digg

Friday, 15 July 2016

A response to The Luminescent's article "VINYĀSA: Medieval and Modern Meanings

Posted on July 15, 2016 by ravi
Interesting article on '' from The Luminescent.
(My post below needs a drastic rewrite - it's more of a work in progress)

"VINYĀSA: Medieval and Modern Meanings

"The term vinyāsa rarely occurs in medieval yoga texts. However, it does appear more frequently in the ritual sections of medieval Tantras. Nonetheless, never does the term vinyāsa mean the movement that links breath with postures (āsana) as is the case in modern yoga."
The Luminescent 



A lot of focus is given to the term Vinyasa in the teaching associated with Pattabhi Jois, as well as 'methodologies' that have derived from his teaching which also emphasise 'Vinyasa', going so far as to name the latter approach to practice Vinyasa Yoga.

Pattabhi Jois, when asked what the method he taught was called supposedly just said Ashtanga. For Pattabhi Jois it seems Yoga was the eight limb Ashtanga methodology outlined by patanjali in his yoga sutras, 'though he focussed on asana as an entry point to that methodology it was still as far as he was concerened, just Yoga, Ashtanga yoga. Later with the focus on vinyasa coming to the fore, no doubt in the 90s especially when Lino Miele and John Scott focussed on the Vinyasa count it started to be referred to as Ashtanga Vinyasa, I tend to call it that myself to distinguish it from Patanjali's Ashtanga in my writing on the blog. Sharath oflate seems to be referring to the practice as Ashtanga Vinyasa Krama. To his crefit pattabhi Jois never wanted to refer to his teaching as Jois Yoga, unfortunately referring to it as Ashtanga has caused perhaps more confusion than it's avoided.

Vinyasa in Pattabhi Jois' teaching has come to be associated with the dynamic movement that perhaps characterises the style/approach/methodology, this is unfortunate. And it is this association of vinyasa with movement that the  Luminescent article seems to be addressing. Pattabhi Jois' methodology is claimed to be Old, going back to a mythological text Yoga Koruna, the only quote from which is supposedly "Hey yogi don't practice asana without vinyasa'. The Luminescent  article questions the understanding of vinyasa as movement historically by pointing out that nowhere is such a usage found in the ancient texts.

I argue here that vinyasa for Pattabhi Jois and his teacher Krishnamacharya is connecting each movement to and from an asana with a stage of the breath such that each stage can be counted, giving a vinyasa count. Also a point of attention is given (fixed) for each movement. For the purpose of shorthand perhaps we may refer to vinyasa as movement but what we are really saying is that each vinyasa is breath stage-movement-with fixed attention. In paschimottanasana in this system there are fifteen such breath stage movements with fixed attention leading too and from the asana. And this is still an asana practice, the vinyasa is the framework for the asana. Krishnamacharya suggests long stays in most of his asana with a pranayama kumbhaka aspect. Rather than just dropping down into one asana then get tingup and doing another, every movement in this approach to and from every asana is fixed on a stage of the breath and point of attention, the whole practice has a focus on the breath as well as perhaps cakra focuse (drishti).

Of course many of Pattabhi Jois students and Krishnamacharya's also were young and focussed on the dynamic aspect of this movement rather than perhaps the asana itself, the breath focus has always been there but the attention perhaps has shifted to the movement and this is perhaps why vinyasa has become associated with movement e specially perhaps to those looking in from outside or who focussed on different aspects of Krishnamacharya's later teaching

*

''Vinyasa' has been used to ground the practice historically, it being suggested that the approach to asana practice derives from a text 'Yoga Korunta' by one Vamana Rishi, the only quote passed around being ' Hey Yogi, don't practice asana without vinyasa'. Pattabhi jois credits his teacher Krishnamacharya with his methodology but other later students of Krishnamacharya have perhaps down played the more dynamic aspect of vinyasa and reinterpreted the term or denigrated it's usage somewhat in Krishnamacharya and his early students teaching

The Luminescent article looks to Vinyasa's historical usage in this article to suggest perhaps that it gives no ground/foundation to the current practice in that vinyasa is rarely used in historical documents and suggest that current usage is a misuse of the term.

Krishnamacharya was a sanskrit scholar and creative debater, I would argue that he made full use of linguistic variants of the term in coining vinyasa in relation to his teaching. I argue below that vinyasa was one complementary aspect of his teaching of yoga and of asana. Vinyasa as breath linked movement acted as compliment to the static nature of his approach to asana with it's long stays and employment of kumbhaka.

Did Krishnamacharya invent this approach to practice, did it derive from his own teacher or a text, we may never know but asana is ancient, as is pranayama, the framework in which that asana is approached no doubt less so, it may only be 80 years old, this should not concern us, asana practice is old enough if such things interest us. As far as the framework is concerned perhaps its enough to ask if it's useful, beneficial and not to lose sight of what is contained within that framework rather than focus too closely on the framework itself.

Note. Some (Vinyasa Yoga ) teachers have sought to ground their teaching in historical accounts where 'vinyasa' is said to be employed, with suggested (perhaps tenuous) links to Krishnamacharya . However, this research never seems to be presented in journals of their peers but rather online magazines and downloadable online courses. I'm not a sanskrit scholar nor an historian, until such research is reviewed by it's peers it's pretty worthless to me, interesting perhaps fascinating even but worthless without review of the evidence by someone qualified to do so, without that it is perhaps f no more value than my own speculations here, based on Krishnamacharya's own texts ( freely downloadable) and my practice of them. 


*

This line below from the Luninecent article struck me and seems to tie in with my own understanding of Vinyasa.

"In discussions on the practice of āsana and other techniques in medieval yoga texts, the term vinyāsa is not used. However, when related verbal forms (such as vinyasya) are used, they mean 'to fix or place'."

This makes sense to me, we tend to focus on the movement these days and think of that as 'the vinyasa' but my understanding is that the vinyasa is 'fixing' the movement to the stage of the breath. Arms going up say on the inhalation, folding over on the exhalation. The point is NOT the movement or the count (vinyasa count - which just follows) but that connection between the breath and the movement as well as the fixing of the attention ( generally the attention is placed between the eyebrows on the inhalation, at the tip of the nose on the exhalation). Lots of 'fixing' and 'placing' in this system. Given Krishnamacharya's fascination with language it would be surprising if he didn't have that usage in mind. I've never tended to believe the system/approach is that old, did Krishnamacharya come up with this inspiration to connect the breath and movement himself, his teacher... it hardly seems to matter.

My current theory is that Krishnamacharya's teacher connected an old text with his interpretation of the yoga sutras and it was that methodology he taught Krishnamacharya over a period of time. Krishnamacharya later sought out the text and perhaps copied out a table of asana with vinyasa and kumbhaka mentioned. Pattabhi Jois mentioned that Krishnamacharya was jumping in and out of asana before he went to teach at Mysore. Perhaps this approach suited the fitness ideas in vogue at the time and was deemed suitable for the boys of the palace. Krishnamacharya put the table in his 1941 text Yogasanagalu, it is clearly incomplete. If Krishnamacharya had developed the table himself surely he would have completed it, I could add the appropriate kumbhaks myself I suspect in a few minutes, Krishnamacharya seemed to want to keep it as it was. BUT Krishnamacharya in his writing always seemed more interested in the Asana, the attention is on long stays, on the breath, the point of attention. While the boys were being led through their dynamic asana practice krishnamacharya would be in an other room teaching private patients where the vinyasa played less of a role although perhaps always implied as it was in his later teaching. It's this weeks theory. 

Krishnamacharya only seemed to be interested in the hatha yoga pradipka and tantra inspired texts when it suited him, he seemed to be more concerned with whether his approach to asana was in keeping with Patanjali, his apprach to yoga sutra 2-47 is perhaps telling

'By making the breath smooth (and long), and by concentration or focussing the mind on the breath, the perfection of the posture is obtained'. See the Appendix for Ramaswami's treatment of this sutra.

"Note: Krishnamacharya interprets this sutra differently than other teachers. He gives the correct technical meaning (in this context) fromn prayatna or Jivana prayatna, or effort of life which is breath. he says that it is the breath that should be made smooth and effortless, not the posture. it is not physical; it is the breathing" p55 Ramaswami

Vinyasa has tended to strike me as being overrated in the Pattabhi Jois tradition or rather given too much attention. My main problem with Mark Singleton's book Yoga Body was that he seemed to look at the practice of Ashtanga Vinyasa yoga, focus on the dynamic, gymnastic, aspect that characterised it's modern practice and then look for gymnastic influences. However a close reading of Krishnamacharya's Yoga Makaranda balances out this view of the practice, the Vinyasa is there to complement the static aspect of the practice of asana, the long stays, the pranayama aspect.

In Krishnamacharya's own writing we do indeed see a focus on the physical quality of the practice, improving the physical condition of the nation was something he argued strongly for in Yoga Makaranda (1934), we see this too in his later Yogasanagalu (1941) where he suggests the vinyasa can keep us strong, even powerful but this for Kishnamacharya is in relation to the other limbs of ashtanga.

Krishnamacharya gives more attention I would argue to the actual asana, where Kumbhaka is practiced and the assumed benefits of the asana stressed. Krishnamacharya writes of long slow breathing, long stays, the vinyasa too and from the asana are more complementary a pratkriya t( counter or compliment  in Krishnamacharya usage) to the static nature of asana.

When the Young Americans came to India of course they focussed on the dynamic aspect of the practice, more so those who followed them. In the 1990s attention was given to the VINYASA COUNT, Vinyasa gained in ever more importance while in Krishnamacharya's own teaching it seemed to decrease as he focussed on older students and helping patients. The vinyasa was often implied more than practiced. Each asana may theoretically begin and end at samastithi but more often than not there would movements to the asana then variations of the asana ( also referred to as vinyasa) practiced. A movement back to Samasathi might come after several asana or even at the end of the practice and might have a more leisurely form not fitting in with the original vinyasa count of his table.

Later students of Krishnamacharya seeing the attention given to the dynamic aspect characterising the practice of the young boys of the Mysore Palace and continued into Pattabhi Jois' teaching and the spin off styles would talk almost dismissively of Vinyasa or they would reinterpret the term as Krishnamacharya himself may have done to more closely reflect their current teaching.

As ever we ended up focussing on one aspect of teaching. In the beginning I too focussed on the movement aspect of Ashtanga practice, a moving meditation, where the attention was fixed on the breath. No sooner had I arrived in one asana than I was ready to enjoy the transition to the next.

Later under Ramaswami's influence I began to focus more on the asana and it's variations as well as the study of Krishnamacharya actual text, again with Ramaswami and began to focus more on the actual asana, on the kumbhaka in particular and later with Shribhashyam's influence, the internal focus of attention during those kumbhaka.

At some point I had lost sight of vinyasa, I was practicing them less. It was only on coming back to reading Yogasanagalu yet again and the passage on vinyasa springing out of me that I rebalanced my practice, enjoying the benefits of the vinyasa as well as of the asana and it's accompanying kumbhaka and focus of attention. Krishnamacharya talked about giving equal attention to each and every breath, to each and every stage of the breath, the inhalation and exhalation but also the kumbhaka between.

The vinyasa approach was a stroke of genius, it allowed us to maintain focus to and from an asana, on every aspect of the breath throughout our postural practice, a ninety minute or more meditation but the vinyasa, the attention given to the movement to and from the asana, also complimented the static asana.

Always in Krishnamacharya the asana practice was integrated in the practice of the other limbs, in the yama and the niyama, the asana would be followed by pranayama, by pratyahara and the meditative limbs.

The mistake is to focus too far on the dynamic aspect of postural practice, it's a mistake made by practitioners and teachers as well as by commentators.


*

Appendix


from Ramaswami’s Vinyasa Krama Newsletters June 2012

Asana and Vinyasa

Vinyása Krama was the mainstay of Krishnamacharya’s teaching of Hata Yoga. The word vinyása is used to indicate an art form of practice. This word is used in several arts, especially in South Indian Carnatic music, a fully evolved classical music system. Vinyása Krama indicates doing ásana with multiple aesthetic variations within the prescribed parameters. Yoga was considered one of sixty-four ancient arts. Hence if you approach yoga ásana practice as an art, that methodology is Vinyása Krama. The beauty and efficacy of yoga is eloquently brought out by Vinyása Krama. What about breath synchronization, another important ingredient of Krishnamacharya’s Vinyása Krama? What about mental focus on the breath while doing ásana practice, central to vinyása yoga? None of the yoga schools teaches yoga in this manner and no classic HathaYoga texts mention breath synchronization in ásana practice specifically. Where can one find references to these?


This was one of the few questions I asked my guru: Is Vinyása Krama an old, traditional practice? Sri Krishnamacharya quoted a verse indicating that reference to this practice can be found in a text called Vrddha Sátápata and also in the Yoga Sutras of Patañjali. There was no point in looking for an obscure text like Väddha Sátápata, but Yoga Sutra was at hand. But where is the reference? There are hardly two Sutras explaining ásana, and there is no reference to breath in them—or is there? Going back to my notes on Yoga Sutra classes with my guru, I found a very interesting interpretation of the sutra, Prayatna-saithilya anantasamápattibhyám. The word prayatna, very commonly used in India, basically means “effort.” saithilya indicates “softness.” So Prayatna- saithilya could mean “mild effort”; hence you find that many writers on the Yoga Sutras declare that the way to achieve perfection in a yoga posture is to “ease into the posture effortlessly.” This is easier said than done. There are hundreds of practitioners who cannot relax enough to be able to easily get into a posture like the Lotus, for example. So we have to investigate the meaning of the word prayatna as used by the darsanakáras in those days. Prayatna according to (Navya)Nyáya, a sibling philosophy to yoga, is a bit involved. Nyáya explains prayatna of three kinds (prayatnaê trividhaê proktam). Two of them are the effort put in for happiness (pravätti) and the effort to remove unhappiness (nivätti). Every being does this all the time. One set of our efforts is always directed toward achieving happiness and the other toward eradicating unhappiness. But the third type of effort relevant here is the effort of life (jàvana-prayatna). What is effort of life? It is the breath or breathing. Now we can say that prayatna-saithilya is to make the breath smooth. Thus in ásana practice according to Vinyása Krama, the breath should be smooth and by implication long (dàrgha).

The other part of the sutra refers to samápatti, or mental focus. Where or on what should the mental focus be? It is to be on ananta (ananta-samápatti). Now we have to investigate the contextual meaning of the word ananta, translated as “endless” or “limitless,” which many writers equate with infinity. So some schools tend to say that while practicing ásanas, one should focus the attention on infinity, which is inappropriate—and impossible, at least for the vast majority of yogàs. Ananta also refers to the serpent, Ädisesa, whose incarnation Patañjali is believed to be. So some schools suggest that one should focus on a mental image of Ädisesa or Patañjali. It may be possible, but it is uncomfortable to think that Patañjali would write that one should focus on his form for the success of ásana practice. So what might ananta symbolically signify? The word ananta can be considered to be derived from the root, “ana”— to breathe (ana sváse). We are all familiar with the group of words--prána, apána, vyána, etc., names of the five pránas derived from the root “ana.” So in the sutra, ananta could mean “breath”; ananta-samápatti is then translated as “focusing the mind on the breath.” In fact Ananta, or the serpent king, is associated with air. In mythology the cobra is associated with air; there is a common mythological belief that cobras live on air. If you look at the icon of Natarája (the dancing Siva), you will find all five elements of the universe (earth, water, air, fire, and space) represented symbolically in Siva. The matted red hair represents fire, the Gangá in his tresses, the water element; the air element is said to be represented by the snake around the Lord’s neck. So ananta- samápatti would mean focusing the attention on the breath or prána.

Thus this sutra means that while practicing ásana, one should do smooth inhalations and exhalations and focus the attention on the breath. Since Vinyása Krama involves several aesthetic movements into and within yoga postures, to achieve the coordination of movement, breath, and mind, one should synchronize the breath with the movement with the help of the focused mind. By such practice, slowly but surely, the union of mind and body takes place, with the breath acting as the harness. But why don’t other texts talk about it? There is a saying, “Anuktam anyato gráhyam.” If some details are missing from one text, they should be gathered from other complementary texts. Hatha-yoga- pradàpiká explains a number of ásanas but does not mention breath synchronization and other basic parameters. But Hatha-yoga-pradàpiká proclaims that its instructions are like a prerequisite for the Rája Yoga practice of Patañjali. These two texts are therefore compatible. Thus we can conclude that Patañjali gives the basic parameters of ásana practice (and also of the other angas like Pránáyáma), but for details we have to refer to compatible texts like Haôha-yoga- pradàpiká,Yoga-Yájñavalkya and others.

My Guru had written a book called “Yogasanangalu” in Kannada, a copy of which I have had for a long time, but never read it as it is in Kannada. Of course I have gone through the wonderful asana pictures of my Guru in it many many times. Recently I found a few pages of the translation in the blog pages of my friend Antony Hall and I am reproducing the relevant portion from it hereunder (Thank You Tony)

Sri Krishnamacharya wrote:

“Vinayasas” many people are curious about its secret. Some others want to know its basis. I agree.
“prayatnashithilyanantasamapattibhyam” (Yoga Sutra II 47)

Please see Patanjala yogasutra and Vyasabhashya (P 2, S 47)

Both type of people (practitioners), be happy . Vachaspathi Misra in that commentary

“Saamsiddhiko hi prayatnah shariradharako na yogangasyopadeshtavyasanasya kaaranam. Tasmat upadeshtavyasanasyayamashadhakah virodhi cha swabhavikah prayatnah. Tasya cha yadruchhikasanahetutayaa sananiyamopahamtyatvat.”

Here is my translation: 
Surely the innate effort--prayatna-- (in every being) is to sustain the body (which is prana, Prana and sariradharaka are considered synonyms). But it (the normal innate breathing) is not helpful in achieving the task on hand (achieving the yoga pose). Therefore the natural/involuntary effort/breathing (swabhavika prayatnah) is counterproductive in achieving the intended goal. Consequently a man, practicing the specific posture as taught, should resort to an effort(prayatna) which consists in the relaxation (saitilya) of the natural/innate(swabhavika) effort (breath). Otherwise the posture taught cannot be accomplished

Krishnamacharya continues to talk about using breath in asanas. “Therefore, how many breathings for which asana? When is inhalation? When is exhalation? In what way? When body is stretched forward, inhalation or exhalation? What about when you raise your head? To know this mystery and practice in order is called Vinayasa. These along with the significance of each asana will be discussed in 1 to 32.”


Email ThisBlogThis!Share to XShare to Facebook
Posted in Krishnamacharya, Vinyasa | No comments
Newer Post Older Post Home
View mobile version

0 comments:

Post a Comment

Subscribe to: Post Comments (Atom)

Popular Posts

  • Ashtanga Advanced series? Why does the Advanced series presentations differ from the 'Original' 1973 Ashtanga syllabus
    I was asked a question about Philippa Asher's Advanced B poster and video I posted a link this week in connection to Philippa's arti...
  • Ashtanga Authorisation 1980 - Present. Includes first ONLINE teaching list (Ashtanga.com 2004) and first AYRI teachers list (2008).
    This post will become a permanent page at the top of the blog, a work in progress attempt to chart the development of the Ashtanga Authorisa...
  • There is no 'official' Ashtanga (sequence).
    I have never been to Mysore and the KPJAYI (Krishna Pattabhi Jois Ashtanga Yoga Institute) and only occasionally, and briefly at that, consi...

Categories

  • #proficientprimaryproject
  • 84 key asana
  • active movement
  • Acupuncture
  • Advanced Ashtanga
  • Advanced Ashtanga demonstration
  • Advanced Ashtanga. Advanced asana
  • advanced B
  • Advanced backbending
  • Advanced series ashtanga
  • Ahtanga
  • alternate breathing in ashtanga
  • Antharanga Sadhana
  • Ardha Baddha Padma Paschimattanasana
  • ardha matsyendrasana
  • arm balances
  • Asana and ageing
  • asana as mudra
  • Ashtanga
  • Ashtanga 4th series.
  • Ashtanga 6th series
  • Ashtanga A
  • Ashtanga Advanced series
  • Ashtanga and addiction
  • ashtanga and ageing
  • Ashtanga and Diet
  • Ashtanga and eating
  • Ashtanga and losing weight
  • Ashtanga and menstruation
  • Ashtanga and recovery
  • Ashtanga and Weight lost
  • ashtanga authorisation
  • Ashtanga B
  • Ashtanga books
  • Ashtanga breathing
  • Ashtanga C
  • Ashtanga in midlife
  • Ashtanga interviews
  • Ashtanga Ladies holiday
  • Ashtanga led
  • Ashtanga lineage
  • Ashtanga Parampara
  • Ashtanga practice
  • Ashtanga primary
  • Ashtanga reading list
  • Ashtanga source
  • Ashtanga syllabus
  • Ashtanga teacher Authorisation
  • Ashtanga underwater
  • Ashtanga vinyasa
  • ashtanga vinyasa count.
  • Ashtanga Viswanath
  • Ashtanga yoga london
  • Ashtanga young boys
  • Ashtanga's origins
  • Asymmetric asana
  • Authorisation
  • AVIDYA
  • B.N.S. Iyengar
  • backbending
  • baddha konasana
  • baddha padmasana
  • beginner yoga reading list
  • Beginning Ashtanga
  • beginning Vinyasa krama
  • beginning vinyasa yoga
  • beginning yoga
  • being stopped at a posture
  • bhagavad gita
  • Bharadvajrasana
  • Bharatanatyam
  • BKS Iyengar
  • BNS Iyengar
  • Bohr effect
  • Book review
  • breathing asana
  • breathing in Ashtanga
  • breathing less
  • chakrasana
  • Chinese medicine and Ashtanga
  • chuck Miller
  • CIRCULO BLANCO
  • Conference notes.
  • cultivate
  • current practice
  • Dandasana
  • Danny Paradise
  • David Roche
  • David Swenson
  • David Williams
  • deep backbends
  • developing a Home practice
  • Dharana
  • Dhyana
  • drishti
  • dropback
  • early asana diploma course
  • early ashtanga vinyasa
  • eka pada sirsasana
  • Emergence of Yoga
  • four key asana
  • Gunas
  • Half Ashtanga series
  • Hamish Hendry
  • hands free lotus
  • hatha yoga
  • Hatha Yoga Pradipka
  • headstand
  • headstand variations.
  • headstands
  • Heartfulness meditation
  • Heartfulness meditation and ashtanga vinyasa yoga
  • hidden postures between postures.
  • History of Ashtanga
  • Home practice
  • Home yoga practice
  • in defence of ashtanga
  • Introduction to breath control
  • inversions
  • Invertions.
  • Jessica Walden
  • Kapotasana
  • karandavasana
  • Karandavasana preparation
  • Keshava Murthy
  • key asana
  • Kino intermediate series
  • Kino MacGregor
  • KPJAYI
  • Krishanacharya
  • krishna
  • Krishnamacharya
  • Krishnamacharya and Buddhism
  • Krishnamacharya and drishti
  • krishnamacharya and the gaze
  • Krishnamacharya backbending
  • Krishnamacharya kumbhaka
  • Krishnamacharya pranayama
  • krishnamacharya pranayama in asana
  • Krishnamacharya quotes
  • Krishnamacharya reading list
  • Krishnamacharya. Is Ashtanga hatha or raja yoga
  • Krishnamacharya's 32 headstands
  • Krishnamacharya's Advanced asana
  • Krishnamacharya's Ashtanga Primary series
  • Krishnamacharya's early Mysore works
  • krishnamacharya's inversions
  • Krishnamacharya's key asana
  • Krishnamacharya's Mysore Yoga students 1941
  • Krishnamacharya's Original Ashtanga Yoga
  • Krishnamacharya's practice guidelines
  • Krishnamacharya's pranayama
  • krishnamacharya7s Ashtanga
  • Kumbhaka
  • ladies holiday
  • lagu vajrasanam supta vajrasana
  • Langhana kriya
  • learn dance hand mudras
  • Learn Sanskrit
  • learning sanskrit yoga names
  • Learning Sanskrit.
  • Learning the sanskrit names for Ashtanga primary series. learning the Ashtanga vinyasa count
  • leg behind head poastures
  • lineage
  • Lineage holder
  • Lino Miele
  • lotus
  • Louise Ellis
  • loving kindness
  • Loving kindness and Yoga Sutras
  • M.S. Viswanath (Masterji)
  • maha bhandasana
  • mahabhandasana
  • mahabharata
  • mahamudra
  • manju jois
  • Manju's new Book
  • Mantra pranayama
  • Mark Darby
  • Mary taylor. subtle body.
  • Masterji
  • meanings of Yoga
  • Meditation and Ashtanga Vinyasa Yoga
  • Menstruation
  • metta
  • modified Ashtanga
  • moola bhandasana
  • moolabhandasana
  • mudra
  • Mudras
  • mula bhandasana
  • mulabhandasana
  • My year in posts
  • Mysore Traditions Movie
  • Mysore yoga demonstration 1941
  • Mysore yoga tradition
  • Nancy Gilgoff
  • newsletters
  • No official ashtanga
  • official ashtanga
  • OM The world of Ashtanga Yogis
  • on Series
  • on vinyasa
  • One breath an asana
  • original Ashtanga
  • original ashtanga syllabus
  • Original ashtanga table
  • Original ashtanga vinyasa count
  • origins of Ashtanga
  • Orisginal Ashtanga syllabus
  • padmasana
  • padmasana variations
  • Paramaguru
  • parampara
  • Patabbhi Jois' nephew
  • patanjali
  • Pattabhi Jois
  • Pattabhi jois Advanced series
  • Pattabhi Jois pranayama
  • Pattabhi Jois'
  • Pattabhi Jois' Yoga Journal letter
  • Perter Brooks Mahabharata
  • Philippa Asher
  • phulgenda Sinha
  • Plagerism
  • practice
  • practicing Yoga at home
  • practicing yoga safely
  • pranayama
  • pranayama mantra
  • Pranidhi Varshney
  • preparation for yoga
  • Proficient primary
  • Puraka (inhalation)
  • Purna matsyendrasana
  • Pushpam
  • R. Sharath Jois
  • Raja yoga
  • Ramamohana Brahmachari'
  • Ramaswami
  • ramaswami chanting
  • Ramaswami newsletters
  • Ramaswami pranayama
  • Ramaswami's key asana
  • Ramswami yoga
  • Recaka (exhalation)
  • Richard Freeman
  • Rishi Series.
  • Roots of Yoga
  • Safer yoga practice
  • Samkhya krika
  • Samyama
  • sañcāra
  • sarvangasana
  • Śavasana
  • savasana Ashtanga take rest
  • science pertaining to the Self within. adhyātmavidyā
  • Sharath
  • Sharath jois
  • Sharath Rangaswamy
  • Sharath Rangaswamy Jois
  • Sharath Utkatasana exit
  • Short Ashtanga practice.
  • Simon Borg-Oliver
  • Simon Borg-Olivier
  • Simon Borg-Olivier pranayama
  • sirsasana
  • Sirsasana (headstand) to Gomukhasana
  • Sirsasana variation
  • Sirsasana variations
  • Sirssana
  • Slow Ashtanga
  • Splashtanga
  • SRI T K SRIBHASHYAM
  • Srivatsa Ramaswami
  • Table of asana
  • Taboo
  • Taḍagī Mudra
  • Taittiriya Upanishad
  • tatakamudra
  • Teaching Ashtanga
  • The Art of Ashtanga vinyasa
  • The Four Immeasurables
  • the Gita as it was
  • THE KALAMA SUTRA
  • the Original gita
  • the Source
  • This is yoga 1941
  • This is yoga life magazine
  • three gunas
  • Tirieng Mukha Eka Pada Paschimattanasana
  • Tolstoy
  • Tolstoyism
  • towards karandavasana
  • traditional Ashtanga
  • traditional ashtanga vinyasa
  • triangamukha Uttanasana
  • underwater yoga
  • Upanishads
  • urdhva dhanurasana
  • Utkatasana
  • Uttihita Padangustasa
  • Vicarious Yoga
  • Vinyasa
  • Vinyasa Krama
  • Vinyasa Krama inverted sequence
  • Vinyasa Krama lotus sequence
  • What I believe
  • What is Ashtanga really
  • What is Ashtanga?
  • Why meditation
  • why practice mudras.
  • Why practice yoga
  • Why Yoga
  • Yamini Murthanna
  • Yoga and aeging
  • yoga and ageing
  • Yoga and blood circulation
  • yoga and Diet
  • Yoga and Osteoporosis
  • Yoga and Women
  • yoga chikitsa
  • Yoga for the three stages of life
  • Yoga Korunta
  • yoga korunti
  • Yoga magazine
  • Yoga Makaranda
  • Yoga Meditation
  • Yoga mudra
  • yoga mudras
  • Yoga raading list
  • Yoga reading list
  • Yoga Sutras
  • Yoga Therapy
  • YogaGlo
  • Yogasanagalu
  • yogasanagalu translation
  • Yogavataranam
  • Zoë Slatoff-Ponté

Blog Archive

  • August 2017 (10)
  • July 2017 (5)
  • June 2017 (7)
  • May 2017 (6)
  • April 2017 (6)
  • March 2017 (9)
  • February 2017 (7)
  • January 2017 (7)
  • December 2016 (4)
  • November 2016 (6)
  • October 2016 (8)
  • September 2016 (6)
  • August 2016 (4)
  • July 2016 (6)
  • June 2016 (4)
  • May 2016 (2)
  • April 2016 (4)
  • March 2016 (16)
  • February 2016 (13)
  • January 2016 (15)
  • December 2015 (5)
Powered by Blogger.

Search This Blog

Report Abuse

  • Home

About Me

ravi
View my complete profile